Pseudomonas aeruginosa PAO1-VE13: N297_2484 Help Entry N297_2484         CDS       T03097                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism paev  Pseudomonas aeruginosa PAO1-VE13 Pathway paev00261   Monobactam biosynthesis paev01100   Metabolic pathways paev01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paev00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     N297_2484  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:paev01008]     N297_2484 Polyketide biosynthesis proteins [BR:paev01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     N297_2484 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGY72380 LinkDB All DBs Position complement(2694541..2694759) Genome browser AA seq 72 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPEYKEIPQGWRAAGKSGLKKDCLAYIEEVWTDMRP LSLRQHMDKAAG NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtgttcgaccgtgacgacatccagttccaggtagtggtcaaccatgaggag cagtattccatctggccggaatacaaggagattccccagggctggcgggcggccggcaag agcggcctgaagaaggactgcctggcctacatcgaggaagtctggaccgacatgcgcccg ctgagcctgcgccagcacatggacaaggcggccggctga

DBGET integrated database retrieval system