Pseudomonas aeruginosa LESB58: PLES_28841 Help Entry PLES_28841        CDS       T00818                                  Name (GenBank) putative MbtH-like protein   KO K05375   MbtH protein Organism pag  Pseudomonas aeruginosa LESB58 Pathway pag00261   Monobactam biosynthesis pag01100   Metabolic pathways pag01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pag00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PLES_28841  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pag01008]     PLES_28841 Polyketide biosynthesis proteins [BR:pag01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PLES_28841 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CAW27611 LinkDB All DBs Position 3140524..3140742 Genome browser AA seq 72 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPEYKEIPQGWRAAGKSGLKKDCLAYIEEVWTDMRP LSLRQHMDKAAG NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtgttcgaccgtgacgacatccagttccaggtagtggtcaaccatgaggag cagtattccatctggccggaatacaaggagattccccagggctggcgggcggccggcaag agcggcctgaagaaggactgcctggcctacatcgaggaagtctggaccgacatgcgcccg ctgagcctgcgccagcacatggacaaggcggccggctga

DBGET integrated database retrieval system