Paenibacillus sp. IHB B 3084: ASL14_11545 Help Entry ASL14_11545       CDS       T05348                                  Name (GenBank) dienelactone hydrolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism paih  Paenibacillus sp. IHB B 3084 Pathway paih00790   Folate biosynthesis paih01100   Metabolic pathways paih01240   Biosynthesis of cofactors Module paih_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:paih00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     ASL14_11545 Enzymes [BR:paih01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      ASL14_11545  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      ASL14_11545  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      ASL14_11545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF2483 Motif Other DBs NCBI-ProteinID:  ALP36698 UniProt:  A0A0S2S4S4 LinkDB All DBs Position complement(2532623..2532985) Genome browser AA seq 120 aa AA seqDB search MDKMVLHRMEYYGYHGVFPEERKLGQRFYIDLELELDLREAGEQDALDKTVNYAEVHYTV KDIVEKESYQLIEALGERIASSLLDTYTSVNALTVKVTKPHPPFDIHFEGVTVELYRARK NT seq 363 nt NT seq  +upstreamnt  +downstreamnt gtggataaaatggttttgcatcgcatggagtattatggatatcatggcgtttttcctgaa gagcgcaagctgggacagcgtttctacattgatttggaactggagcttgatctgcgtgag gcaggcgagcaggatgcattggacaaaacggttaattacgctgaggtgcattacaccgtt aaagatattgtagaaaaggaatcttaccaattgattgaagctttgggcgaacgtattgca tcttccttactggacacttatactagtgtcaatgcactgactgtcaaagtcacaaagccg catccgccgttcgatattcattttgagggcgtgacggttgagctttatcgcgcaagaaag tag

DBGET integrated database retrieval system