Pseudomonas alloputida: LU682_011130 Help Entry LU682_011130      CDS       T09345                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pald  Pseudomonas alloputida Pathway pald00261   Monobactam biosynthesis pald01100   Metabolic pathways pald01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pald00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LU682_011130  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pald01008]     LU682_011130 Polyketide biosynthesis proteins [BR:pald01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LU682_011130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WJR19338 LinkDB All DBs Position 2425530..2425751 Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPDYKAIPNGWRAVGKSGLKKDCLAYIDEVWTDMRP LSLRQKMAEAAAQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacttccgttttcgaccgcgacgatatccagttccaggtagtggtcaaccacgaagag caatactcgatctggcccgactacaaagccatccccaatggctggcgagccgtgggcaaa agcggcctgaagaaggactgcctggcctacatcgatgaagtctggaccgacatgcgcccg ctgagcctgcgccagaaaatggccgaagctgccgcccagtga

DBGET integrated database retrieval system