Paracoccus alcaliphilus: JHW40_22580 Help Entry JHW40_22580       CDS       T08960                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism palp  Paracoccus alcaliphilus Pathway palp00261   Monobactam biosynthesis palp01100   Metabolic pathways palp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:palp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     JHW40_22580  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:palp01008]     JHW40_22580 Polyketide biosynthesis proteins [BR:palp01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     JHW40_22580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WCR21003 LinkDB All DBs Position p305818:complement(97478..97696) Genome browser AA seq 72 aa AA seqDB search MSNPFDDQDGIFLVLVNDENQHSLWPEFAAVPEGWRSVFGPDKRPACIDYVETSWTDMRP ASLVAMETEKAA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccctttgacgatcaggacggtatcttcctcgtgctggtgaacgacgagaac cagcattcgctctggcccgaattcgccgccgtccccgaaggctggcgcagcgtcttcggc ccggacaagcgtccggcctgcatcgactatgtcgagaccagctggaccgacatgcgcccg gccagccttgtcgcgatggaaaccgagaaggctgcctga

DBGET integrated database retrieval system