Pseudomonas alvandae: KSS97_20135 Help Entry KSS97_20135       CDS       T07736                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism palv  Pseudomonas alvandae Pathway palv00261   Monobactam biosynthesis palv01100   Metabolic pathways palv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:palv00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KSS97_20135  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:palv01008]     KSS97_20135 Polyketide biosynthesis proteins [BR:palv01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KSS97_20135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QXI51827 LinkDB All DBs Position complement(4565236..4565463) Genome browser AA seq 75 aa AA seqDB search MTSVFDREDILFQVVVNHEEQYSIWPDYKAVPEGWRTVGKSGFKKECLAYIEEVWTDMRP LSLRKKMEEQAAAAH NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtattcgaccgcgaggacatcctcttccaggtcgtggtcaaccacgaagaa cagtattcgatctggccggactacaaggccgttcccgagggctggcgcaccgtcggcaag agcggcttcaagaaggaatgcctggcctacatcgaagaggtctggaccgacatgcggccg ttgagcttgcgcaagaagatggaagagcaggcggcagcggctcactaa

DBGET integrated database retrieval system