Pseudomonas amygdali: BKM19_012270 Help Entry BKM19_012270      CDS       T05354                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pamg  Pseudomonas amygdali Pathway pamg00261   Monobactam biosynthesis pamg01100   Metabolic pathways pamg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pamg00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BKM19_012270  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pamg01008]     BKM19_012270 Polyketide biosynthesis proteins [BR:pamg01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BKM19_012270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AVB14278 LinkDB All DBs Position 2410856..2411074 Genome browser AA seq 72 aa AA seqDB search MTSVFDREDIVFQVVVNHEEQYSIWPDYKAIPNGWRTVGKSGFKKECLAYIEEVWTDMRP LSLRQKMEAQTA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtattcgatcgggaagacatcgtctttcaagttgtggtcaaccacgaagaa cagtattcgatctggcccgactacaaagccatccccaacggctggcgcaccgttggcaaa agcggcttcaagaaagagtgcctggcctacatcgaagaagtctggaccgacatgcgcccc ctgagcctgcgccagaaaatggaagcgcagacggcctga

DBGET integrated database retrieval system