Paenibacillus amylolyticus: P9222_06360 Help Entry P9222_06360       CDS       T09036                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pamy  Paenibacillus amylolyticus Pathway pamy00261   Monobactam biosynthesis pamy01100   Metabolic pathways pamy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pamy00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     P9222_06360  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pamy01008]     P9222_06360 Polyketide biosynthesis proteins [BR:pamy01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     P9222_06360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WFR63862 LinkDB All DBs Position 1291170..1291406 Genome browser AA seq 78 aa AA seqDB search MSNPFEYEDSNYLVLMNDEGQYSLWPASIAVPAGWTLMLGKAKRRVCLDYIAEQWTDLKP LSLCDETGMPGMIHEVGR NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccttttgaatatgaagacagcaattatctggtgttaatgaatgatgaagga cagtattcgctgtggcctgcatccatagcggtaccggcaggttggaccctgatgctgggg aaagccaaacgacgtgtatgtctggattacattgcggagcagtggacggacctgaagccg ctgagtctctgtgatgaaacggggatgccgggcatgattcatgaggtaggcagatga

DBGET integrated database retrieval system