Paenisporosarcina antarctica: E2636_18470 Help Entry E2636_18470       CDS       T05927                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism panc  Paenisporosarcina antarctica Pathway panc00790   Folate biosynthesis panc01100   Metabolic pathways panc01240   Biosynthesis of cofactors Module panc_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:panc00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     E2636_18470 (folB) Enzymes [BR:panc01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      E2636_18470 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      E2636_18470 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      E2636_18470 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF1997 Motif Other DBs NCBI-ProteinID:  QBP42998 UniProt:  A0A4P7A2T8 LinkDB All DBs Position 3890035..3890403 Genome browser AA seq 122 aa AA seqDB search MDYIHVNEMEFWGNHGVFAEETKLGQRFRVTLSLAVDLQEAGQTDDLEKTVNYAEAFFIC QKIVETNPAKLVETVAERIATEILTKFKGRVKGCKVMVIKPDPPIPGHYRSIAVEITRGE FV NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggattatattcatgtgaacgaaatggaattctggggaaatcatggagtgtttgctgaa gaaacaaaacttggccaacgattccgcgttacgctttcgctagctgttgatttgcaagaa gccggtcaaacggatgatttagagaaaaccgttaactatgcagaggcgttcttcatttgc caaaagattgttgaaacgaaccctgcgaaattagttgaaactgtagcggaacgtatcgca acggaaattctaacgaagttcaaaggtcgtgttaagggctgtaaagtgatggtaattaaa ccagaccctccaattccaggccattatcgttcaattgctgttgaaattacaagaggtgag tttgtgtga

DBGET integrated database retrieval system