Pseudomonas anuradhapurensis: HU763_010240 Help Entry HU763_010240      CDS       T07691                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism panh  Pseudomonas anuradhapurensis Pathway panh00261   Monobactam biosynthesis panh01100   Metabolic pathways panh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:panh00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HU763_010240  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:panh01008]     HU763_010240 Polyketide biosynthesis proteins [BR:panh01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HU763_010240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QXI49779 LinkDB All DBs Position 2209614..2209835 Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDIQFQVVANHEEQYSIWPDYKAIPNGWRAVGKSGLKKDCLAYIDEVWTDMRP LSLRQKMAEAAAQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacttccgttttcgaccgcgacgatatccagttccaggtagtggccaaccacgaagag cagtactcgatctggcccgactacaaggccatccccaacggctggcgcgccgttggcaag agcggcctgaagaaagactgccttgcctacatcgacgaagtctggaccgacatgcgcccg ctgagcctgcgccagaaaatggccgaagccgctgcccagtga

DBGET integrated database retrieval system