Pseudomonas antarctica: A7J50_4055 Help Entry A7J50_4055        CDS       T04830                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism panr  Pseudomonas antarctica Pathway panr00261   Monobactam biosynthesis panr01100   Metabolic pathways panr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:panr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     A7J50_4055  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:panr01008]     A7J50_4055 Polyketide biosynthesis proteins [BR:panr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     A7J50_4055 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ANF87416 UniProt:  A0A172Z5G9 LinkDB All DBs Position complement(4473050..4473274) Genome browser AA seq 74 aa AA seqDB search MTSVFDRDDILFQVVVNHEEQYSIWPDYKVVPEGWRTVGKSGMKKECLAYIEEVWTDMRP LSLRQKMDAAALAS NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacctcagtatttgaccgcgacgacatcctgtttcaggtagtggtcaaccacgaagaa cagtattccatctggcccgactacaaggtcgtaccggaaggctggcgcaccgtgggcaag agcggcatgaagaaagagtgcctggcttacatcgaagaagtctggaccgatatgcgcccg ctgagcctgcgtcagaagatggacgctgctgcgctggccagctga

DBGET integrated database retrieval system