Pantoea sp. SO10: FCN45_21750 Help Entry FCN45_21750       CDS       T06053                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pans  Pantoea sp. SO10 Pathway pans00261   Monobactam biosynthesis pans01100   Metabolic pathways pans01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pans00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     FCN45_21750  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pans01008]     FCN45_21750 Polyketide biosynthesis proteins [BR:pans01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     FCN45_21750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QCP62024 LinkDB All DBs Position unnamed1:complement(492852..493073) Genome browser AA seq 73 aa AA seqDB search MSEQQNPFDNDALDFLVLINARQQYSLWPAFASVPAGWHNVAGPLTRSAAIEFIEANWHD MRPATQQTSSTAA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgtctgaacaacagaatccgtttgataacgatgcgctcgattttctggtgctgattaac gcgcgccagcaatacagcctgtggcccgcttttgcttcggttccggcaggttggcacaac gtggcgggaccgctgacgcgcagcgctgccattgagtttatcgaagcaaactggcacgac atgcggccagcgacgcaacagacgtcgtctaccgcagcttaa

DBGET integrated database retrieval system