Papio anubis (olive baboon): 101023446 Help Entry 101023446         CDS       T07474                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism panu  Papio anubis (olive baboon) Pathway panu01523   Antifolate resistance panu04010   MAPK signaling pathway panu04060   Cytokine-cytokine receptor interaction panu04064   NF-kappa B signaling pathway panu04217   Necroptosis panu04380   Osteoclast differentiation panu04620   Toll-like receptor signaling pathway panu04621   NOD-like receptor signaling pathway panu04623   Cytosolic DNA-sensing pathway panu04625   C-type lectin receptor signaling pathway panu04640   Hematopoietic cell lineage panu04657   IL-17 signaling pathway panu04659   Th17 cell differentiation panu04668   TNF signaling pathway panu04750   Inflammatory mediator regulation of TRP channels panu04932   Non-alcoholic fatty liver disease panu04933   AGE-RAGE signaling pathway in diabetic complications panu04936   Alcoholic liver disease panu04940   Type I diabetes mellitus panu05010   Alzheimer disease panu05020   Prion disease panu05022   Pathways of neurodegeneration - multiple diseases panu05132   Salmonella infection panu05133   Pertussis panu05134   Legionellosis panu05135   Yersinia infection panu05140   Leishmaniasis panu05142   Chagas disease panu05143   African trypanosomiasis panu05144   Malaria panu05146   Amoebiasis panu05152   Tuberculosis panu05162   Measles panu05163   Human cytomegalovirus infection panu05164   Influenza A panu05168   Herpes simplex virus 1 infection panu05171   Coronavirus disease - COVID-19 panu05321   Inflammatory bowel disease panu05323   Rheumatoid arthritis panu05332   Graft-versus-host disease panu05417   Lipid and atherosclerosis panu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101023446 (IL1B)    04064 NF-kappa B signaling pathway     101023446 (IL1B)    04668 TNF signaling pathway     101023446 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101023446 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101023446 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     101023446 (IL1B)    04620 Toll-like receptor signaling pathway     101023446 (IL1B)    04621 NOD-like receptor signaling pathway     101023446 (IL1B)    04623 Cytosolic DNA-sensing pathway     101023446 (IL1B)    04625 C-type lectin receptor signaling pathway     101023446 (IL1B)    04659 Th17 cell differentiation     101023446 (IL1B)    04657 IL-17 signaling pathway     101023446 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     101023446 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     101023446 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     101023446 (IL1B)    05164 Influenza A     101023446 (IL1B)    05162 Measles     101023446 (IL1B)    05168 Herpes simplex virus 1 infection     101023446 (IL1B)    05163 Human cytomegalovirus infection     101023446 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     101023446 (IL1B)    05135 Yersinia infection     101023446 (IL1B)    05133 Pertussis     101023446 (IL1B)    05134 Legionellosis     101023446 (IL1B)    05152 Tuberculosis     101023446 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     101023446 (IL1B)    05144 Malaria     101023446 (IL1B)    05140 Leishmaniasis     101023446 (IL1B)    05142 Chagas disease     101023446 (IL1B)    05143 African trypanosomiasis     101023446 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     101023446 (IL1B)    05321 Inflammatory bowel disease     101023446 (IL1B)    05332 Graft-versus-host disease     101023446 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     101023446 (IL1B)    05020 Prion disease     101023446 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     101023446 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101023446 (IL1B)    05418 Fluid shear stress and atherosclerosis     101023446 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     101023446 (IL1B)    04936 Alcoholic liver disease     101023446 (IL1B)    04932 Non-alcoholic fatty liver disease     101023446 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     101023446 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     101023446 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:panu04052]     101023446 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:panu00536]     101023446 (IL1B) Cytokines and neuropeptides [BR:panu04052]  Cytokines   Interleukins    101023446 (IL1B) Glycosaminoglycan binding proteins [BR:panu00536]  Heparan sulfate / Heparin   Cytokines    101023446 (IL1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  101023446 NCBI-ProteinID:  XP_003909194 Ensembl:  ENSPANG00000000795 UniProt:  A0A2I3N9K4 LinkDB All DBs Position 14:90567408..90574585 Genome browser AA seq 268 aa AA seqDB search MAEVPELASEMMAYYSGNEDDLFFEVDGPKQMKCSFQDLDLCPLDGGIQLQISHEHYNRG FRQAVSVVVAMEKLRKMLVPCPQTFQDNDLSTLIPFIFEEEPVFLDTCNNDACVHDAPVR SLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKVPVALGLKA KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST SQAENMPVFLGGTRGGQDITDFTMQFAS NT seq 807 nt NT seq  +upstreamnt  +downstreamnt atggcagaagtacctgaactcgccagtgaaatgatggcttactacagcggcaacgaggat gacttgttctttgaagtcgatggccctaaacagatgaagtgctccttccaggatctagac ctctgccctctggatggcggcatccagctacaaatctcccacgagcactacaacaggggc ttccggcaggccgtgtcggttgttgtagccatggagaagctaaggaagatgctggttccc tgcccacagaccttccaggacaatgacctgagcaccttgattcccttcatctttgaagaa gaacctgtcttcctcgacacatgcaataacgacgcttgtgtgcatgatgcacctgtacga tcactgcactgcacactccgggatgcacagctcaaaagcttggtgatgtctggtccatat gaactgaaagctctccacctccagggacaggatctggagcaacaagtggtgttctccatg tcctttgtacaaggagaagaaagtaatgacaaagtacctgtggccttgggcctcaaggca aagaacctgtacctgtcctgcgtgttgaaagatgataagcccacgctacagctggagagt gtagatcccaaaaattacccaaagaagaagatggaaaagcgatttgtcttcaacaagata gaaatcaataacaagctggaatttgagtctgcccaattccccaactggtacatcagcacc tctcaagcagaaaatatgcccgtcttcctgggagggaccagaggtggccaggatataact gacttcaccatgcaatttgcgtcttga

DBGET integrated database retrieval system