Pseudomonas aeruginosa PA7: PSPA7_2847 Help Entry PSPA7_2847        CDS       T00569                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism pap  Pseudomonas aeruginosa PA7 Pathway pap00261   Monobactam biosynthesis pap01100   Metabolic pathways pap01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pap00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PSPA7_2847  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pap01008]     PSPA7_2847 Polyketide biosynthesis proteins [BR:pap01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PSPA7_2847 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABR86930 UniProt:  A6V572 LinkDB All DBs Position 2900665..2900883 Genome browser AA seq 72 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPEYKEIPQGWRAAGKSGLKKDCLAYIEEVWTDMRP LSLRQHMDKAAG NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtgttcgaccgtgacgacatccagttccaggtagtggtcaaccatgaggag cagtattccatctggccggaatacaaggagattccccagggctggcgggcggccggcaag agcgggctgaagaaggactgcctggcctacatcgaggaagtctggaccgacatgcgcccg ctgagcctgcgccagcacatggacaaggcggccggctga

DBGET integrated database retrieval system