Pyrofollis japonicus: PYJP_01910 Help Entry PYJP_01910        CDS       T09484                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pare  Pyrofollis japonicus Pathway pare00020   Citrate cycle (TCA cycle) pare00720   Carbon fixation pathways in prokaryotes pare01100   Metabolic pathways pare01110   Biosynthesis of secondary metabolites pare01120   Microbial metabolism in diverse environments pare01200   Carbon metabolism pare01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pare00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     PYJP_01910   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     PYJP_01910 Enzymes [BR:pare01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      PYJP_01910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_10 Fer4_9 Fer4_2 Fer4_8 Fer4_6 Fer4_21 Fer4_4 Fer4_16 Fer4_17 Fer4_3 Fer4_13 Motif Other DBs NCBI-ProteinID:  BEP16839 LinkDB All DBs Position complement(180944..181261) Genome browser AA seq 105 aa AA seqDB search MGVVDGGVLVSSKRAFDIIILADRCKECGLCIHVCPKKILVTGDKQNKKGYRVTTVTKPS LCIGCRLCEFSCPDFVLRIEPSSDGVAKALMVWGDGQVEVITDQS NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgttgtggatggtggtgtgttagtgtcttcgaaacgcgcgtttgatataattatt ctcgccgataggtgcaaggagtgcggcctctgcatacatgtttgccccaaaaagatcctc gtgaccggggacaagcagaacaagaagggctacagggtcacaaccgtcactaagccctct ctgtgcataggctgccggctctgcgagttcagctgccccgacttcgttctaagaatagag ccatccagcgacggcgtagccaaggccctaatggtttggggcgatggccaagtagaagtc ataactgatcagagttag

DBGET integrated database retrieval system