Priestia aryabhattai: I5S86_11795 Help Entry I5S86_11795       CDS       T07135                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism parh  Priestia aryabhattai Pathway parh00261   Monobactam biosynthesis parh01100   Metabolic pathways parh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:parh00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     I5S86_11795  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:parh01008]     I5S86_11795 Polyketide biosynthesis proteins [BR:parh01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     I5S86_11795 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QPN47523 LinkDB All DBs Position 2555793..2556014 Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPDYKAIPNGWRAVGKSGLKKDCLAYIDEVWTDMRP LSLRQKMADAAAQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacttccgttttcgaccgcgacgatatccagttccaggtagtggtcaaccacgaagag caatattccatctggcccgactacaaggcgatccccaacggctggcgcgctgtgggcaag agcgggctgaaaaaggactgcctggcctacatcgacgaagtctggaccgatatgcgcccg ctgagcctgcgccagaagatggcggacgctgccgcacagtga

DBGET integrated database retrieval system