Pseudomonas asgharzadehiana: KSS96_20220 Help Entry KSS96_20220       CDS       T07697                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pasg  Pseudomonas asgharzadehiana Pathway pasg00261   Monobactam biosynthesis pasg01100   Metabolic pathways pasg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pasg00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KSS96_20220  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pasg01008]     KSS96_20220 Polyketide biosynthesis proteins [BR:pasg01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KSS96_20220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QXH65921 LinkDB All DBs Position complement(4477483..4477704) Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDILFQVVVNHEEQYSIWPDYKAVPEGWRTVGKSGLKKECLAYIEETWTDMRP LSLRQKMDGAALA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacctcagtatttgaccgcgacgacatcctgtttcaggtagtggtcaaccatgaagaa caatattccatctggcccgactacaaggccgtgccggaaggttggcgcaccgtgggcaag agcggtctgaaaaaagaatgcctggcctacattgaagaaacctggaccgacatgcgcccg ttaagcctgcgccagaaaatggacggcgctgcgctggcctga

DBGET integrated database retrieval system