Pseudomonas asiatica: LG197_21880 Help Entry LG197_21880       CDS       T08841                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pasi  Pseudomonas asiatica Pathway pasi00261   Monobactam biosynthesis pasi01100   Metabolic pathways pasi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pasi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LG197_21880  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pasi01008]     LG197_21880 Polyketide biosynthesis proteins [BR:pasi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LG197_21880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WDM87250 LinkDB All DBs Position complement(4735599..4735820) Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPDYKAIPNGWRAVGKSGLKKDCLAYIDEVWTDMRP LSLRQKMAEAAAQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacttccgttttcgaccgcgacgatatccagttccaggtagtggtcaaccacgaagag caatactcgatctggcccgactacaaagccatccccaacggctggcgtgccgtaggcaag agcggcctgaagaaggactgcctggcctacatcgatgaagtctggaccgacatgcgcccg ctgagcctgcgccagaaaatggccgaagccgccgcccagtga

DBGET integrated database retrieval system