Paraglaciecola sp. T6c: Patl_1044 Help Entry Patl_1044         CDS       T00372                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism pat  Paraglaciecola sp. T6c Pathway pat00790   Folate biosynthesis pat01100   Metabolic pathways pat01240   Biosynthesis of cofactors Module pat_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:pat00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Patl_1044 Enzymes [BR:pat01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Patl_1044  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Patl_1044  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Patl_1044 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ABG39570 UniProt:  A0A9J9EQE6 LinkDB All DBs Position 1248292..1248651 Genome browser AA seq 119 aa AA seqDB search MDKIYIEGLEVQSLIGVYDWERDATQRLLVDIVLFSDLQKPAYSDDVDDTLNYAEVAQAV TDVAAKSQFALIEALAQAMINQVFSQFPVQKMTLKLSKPDILPSAQNVAVEFTRERKDT NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggataaaatttacattgaaggcttagaggtacaatctctaataggcgtgtacgattgg gagcgggatgcgacgcagcgattgctggtcgatatagtgttatttagtgatttacaaaag cctgcctatagcgatgatgttgacgatacgctgaattacgctgaggtagcacaagctgtg acagacgtggctgcaaagagtcaatttgcgttaattgaagcgctagctcaagccatgatc aaccaagtcttcagccaatttcctgtgcaaaaaatgaccttgaaattgagcaaacctgac attttaccttcagctcaaaatgtcgcggtcgagtttactcgtgagcgcaaagacacatga

DBGET integrated database retrieval system