Pseudomonas aeruginosa UCBPP-PA14: PA14_33510 Help Entry PA14_33510        CDS       T00401                                  Name (GenBank) putative MbtH-like protein   KO K05375   MbtH protein Organism pau  Pseudomonas aeruginosa UCBPP-PA14 Pathway pau00261   Monobactam biosynthesis pau01100   Metabolic pathways pau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pau00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PA14_33510  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pau01008]     PA14_33510 Polyketide biosynthesis proteins [BR:pau01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PA14_33510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABJ11588 UniProt:  A0A0H2ZBG4 LinkDB All DBs Position 2949029..2949247 Genome browser AA seq 72 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPEYKEIPQGWRAAGKSGLKKDCLAYIEEVWTDMRP LSLRQHMDKAAG NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtgttcgaccgtgacgacatccagttccaggtagtggtcaaccatgaggag cagtattccatctggccggaatacaaggagattccccagggctggcgggcggccggcaag agcggcctgaagaaggactgcctggcctacatcgaggaagtctggaccgacatgcgcccg ctgagcctgcgccagcacatggacaaggcggccggctga

DBGET integrated database retrieval system