Pistricoccus aurantiacus: FGL86_11055 Help Entry FGL86_11055       CDS       T06130                                  Name (GenBank) hypothetical protein   KO K02277   cytochrome c oxidase subunit IV [EC:7.1.1.9] Organism paur  Pistricoccus aurantiacus Pathway paur00190   Oxidative phosphorylation paur01100   Metabolic pathways Module paur_M00155   Cytochrome c oxidase, prokaryotes Brite KEGG Orthology (KO) [BR:paur00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     FGL86_11055 Enzymes [BR:paur01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.9  cytochrome-c oxidase      FGL86_11055 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  COX4_pro CcmD Motif Other DBs NCBI-ProteinID:  QEA39563 UniProt:  A0A5B8SXG5 LinkDB All DBs Position complement(2317110..2317373) Genome browser AA seq 87 aa AA seqDB search MGAVAVLFLTWICLLVLLAISVTSVVLLSLPWSLVAVGVCALCMILLIIILFMDLRNSRG LTRVYATGAVLWLAFLITLTLMDYLHR NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgggtgccgtcgccgttctttttcttacctggatctgcctgctggtattgctggcaatc tccgtcaccagcgtcgtgcttctatcgctgccctggagcctggtggcagtcggggtctgc gcgctatgcatgatcctgctgatcatcatcctgttcatggatctcaggaacagccgcggc ctgacccgggtctacgccaccggcgccgtgctctggctggcctttctgatcaccctgacc ctgatggattatctgcatcgctga

DBGET integrated database retrieval system