Pseudonocardia autotrophica: Pdca_23610 Help Entry Pdca_23610        CDS       T06156                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism paut  Pseudonocardia autotrophica Pathway paut00261   Monobactam biosynthesis paut01100   Metabolic pathways paut01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paut00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Pdca_23610  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:paut01008]     Pdca_23610 Polyketide biosynthesis proteins [BR:paut01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Pdca_23610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BBG01152 LinkDB All DBs Position 2494288..2494524 Genome browser AA seq 78 aa AA seqDB search MSTNPFDDEDGEFHALVNDEGQYSLWPTFAEVPSGWTVAYGPGPRQDVLDHIEQVWTDMR PRSLVERMERDAGEHAGG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcgacgaacccgtttgacgacgaggacggcgagttccacgccctcgtgaacgacgag ggccagtactcgctctggccgacgttcgccgaggtcccgtccggctggaccgtggcgtac ggccccggcccccggcaggacgtgctcgaccacatcgagcaggtatggaccgacatgcgc ccgagaagtctggtcgagcggatggagcgcgacgcgggcgagcacgccggtgggtga

DBGET integrated database retrieval system