Pseudomonas azerbaijanorientalis: KSS91_08435 Help Entry KSS91_08435       CDS       T07706                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism paze  Pseudomonas azerbaijanorientalis Pathway paze00261   Monobactam biosynthesis paze01100   Metabolic pathways paze01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paze00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KSS91_08435  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:paze01008]     KSS91_08435 Polyketide biosynthesis proteins [BR:paze01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KSS91_08435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QXH63503 LinkDB All DBs Position 1921311..1921538 Genome browser AA seq 75 aa AA seqDB search MTSVFDREDILFQVVVNHEEQYSIWPDYKAVPQGWRTVGKSGLKKECLVYIEETWTDMRP LSLRQKMDEQAAVAN NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtattcgaccgcgaggacatcctctttcaggtcgtggtcaaccatgaagag caatactcgatctggcctgattacaaagccgtacctcagggctggcgcaccgtgggtaaa agcgggctgaaaaaggaatgcctggtctatatcgaagagacctggactgacatgcgtccg ttgagtctgcgccagaagatggatgagcaggcggctgtggcgaactga

DBGET integrated database retrieval system