Python bivittatus (Burmese python): 103057381 Help Entry 103057381         CDS       T03091                                  Name (RefSeq) ferritin heavy chain A-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism pbi  Python bivittatus (Burmese python) Pathway pbi00860   Porphyrin metabolism pbi04216   Ferroptosis pbi04217   Necroptosis Brite KEGG Orthology (KO) [BR:pbi00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     103057381  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     103057381    04217 Necroptosis     103057381  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pbi04147]     103057381 Enzymes [BR:pbi01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      103057381 Exosome [BR:pbi04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103057381   Exosomal proteins of bladder cancer cells    103057381 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin HEPN_RES_NTD1 DUF5344 Motif Other DBs NCBI-GeneID:  103057381 NCBI-ProteinID:  XP_007441446 UniProt:  A0A9F2RA18 LinkDB All DBs Position Unknown AA seq 142 aa AA seqDB search ACHFDRDDVALCHVAEFLRKQSQKAWEQAEKFLKYQNKRGGRAVLQDIKKPEQDDWGNSL DVLQKALQLEKNVNQSLLQLHKLAKEKEDPHLCAFLESEYLEEQVKTIKGLGDHLTNLKR LGLPQNGIGEYLFNKLTLQDSS NT seq 429 nt NT seq  +upstreamnt  +downstreamnt gcttgccattttgaccgtgatgatgtagccctgtgtcatgttgctgagttcctgagaaaa caatcacagaaagcctgggagcaagcagagaagtttttaaaataccagaacaaaagggga ggtcgagcggtcctacaggacatcaagaagccagagcaagatgactggggaaatagcttg gatgtcctacagaaagccctacaactggaaaagaatgtgaaccaatccctgttgcaactc cacaaactggccaaggagaaagaagatccccatctctgtgccttcttggagtctgaatac ctggaggagcaagtgaagaccatcaaggggctgggggaccatctcaccaacctgaagcgc ctggggttgccccagaatggcataggggaatacctcttcaacaagctcactttacaggac agcagctga

DBGET integrated database retrieval system