Desulfobaculum bizertense: LWC08_09340 Help Entry LWC08_09340       CDS       T07819                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pbiz  Desulfobaculum bizertense Pathway pbiz00020   Citrate cycle (TCA cycle) pbiz01100   Metabolic pathways pbiz01110   Biosynthesis of secondary metabolites pbiz01120   Microbial metabolism in diverse environments pbiz01200   Carbon metabolism pbiz01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pbiz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     LWC08_09340 Enzymes [BR:pbiz01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      LWC08_09340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_21 Fer4_4 Fer4_9 Fer4_2 Fer4_8 Fer4_10 Fer4_6 Fer4_17 Fer4_16 Fer4_13 Fer4_3 Motif Other DBs NCBI-ProteinID:  UIJ36941 LinkDB All DBs Position 2004442..2004705 Genome browser AA seq 87 aa AA seqDB search MAKPKKGQTTITVYPDWCKACGLCVAFCPGKVLELDTVAGCARVVREEECINCGFCELHC PDFAIVVTPKAHAAEQNAPKKEAGGSQ NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggccaaacccaagaaaggacaaactaccatcaccgtgtaccccgactggtgcaaggca tgtgggctgtgtgtcgcattctgtcccggaaaggtgcttgagctcgacaccgttgctgga tgtgctcgagtggtgcgggaagaggaatgtatcaactgtggcttttgcgagctgcactgc ccagacttcgcaatcgttgtgacgcccaaagcacacgctgctgaacagaacgcgcccaaa aaagaggcaggaggcagtcaatga

DBGET integrated database retrieval system