Paenibacillus bovis: AR543_20110 Help Entry AR543_20110       CDS       T04407                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism pbv  Paenibacillus bovis Pathway pbv00261   Monobactam biosynthesis pbv01100   Metabolic pathways pbv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pbv00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AR543_20110  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pbv01008]     AR543_20110 Polyketide biosynthesis proteins [BR:pbv01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AR543_20110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ANF98086 UniProt:  A0A172ZKD2 LinkDB All DBs Position complement(4754566..4754778) Genome browser AA seq 70 aa AA seqDB search MNNPFEQIDGQYIVLINEEHQYSLWPAAMDIPAGWSVSLSVADRQTCMDYIAENWQDLRP RSIRQQTAVR NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgaataatccatttgagcagatcgatgggcagtatattgtactaatcaatgaagaacac cagtattcgctctggccggcagccatggatataccggcaggttggtcggtctccttgtcg gttgcagatcggcagacctgcatggattatattgccgagaactggcaggatttgagaccg cgcagtatccgtcagcagacggctgttcgttaa

DBGET integrated database retrieval system