Pieris brassicae (large cabbage white): 123707021 Help Entry 123707021         CDS       T08632                                  Name (RefSeq) GTPase HRas   KO K07827   GTPase KRas Organism pbx  Pieris brassicae (large cabbage white) Pathway pbx04013   MAPK signaling pathway - fly pbx04068   FoxO signaling pathway pbx04137   Mitophagy - animal pbx04140   Autophagy - animal pbx04150   mTOR signaling pathway pbx04213   Longevity regulating pathway - multiple species pbx04214   Apoptosis - fly pbx04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:pbx00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     123707021    04068 FoxO signaling pathway     123707021    04150 mTOR signaling pathway     123707021  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     123707021    04137 Mitophagy - animal     123707021   09143 Cell growth and death    04214 Apoptosis - fly     123707021  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     123707021   09149 Aging    04213 Longevity regulating pathway - multiple species     123707021  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pbx04131]     123707021   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:pbx04031]     123707021 Membrane trafficking [BR:pbx04131]  Endocytosis   Macropinocytosis    Ras GTPases     123707021 GTP-binding proteins [BR:pbx04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     123707021 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Motif Other DBs NCBI-GeneID:  123707021 NCBI-ProteinID:  XP_045512724 EnsemblRapid:  ENSPBSG00000015705 LinkDB All DBs Position 3:complement(18655658..18660657) Genome browser AA seq 191 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGSYREQIKRVKDAEEVPMVLVGNKCDL QAWAVDMTQAREVARSYGVPFVETSAKTRMGVDDAFYTLVREIRKDKESRGKKFRRGNKL GSRRSFKCTLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagttggttgtggttggtgctggaggcgtcggtaaatcagccttgact atacagctgatacagaatcattttgtggacgagtatgacccaacgatagaagactcctat aggaagcaagtagtaatagatggagagacttgcctgttggacatcttggacacggctggc caagaggagtattcagctatgagagatcagtatatgcgaactggtgaagggtttctgcta gtgtttgcagtgaacagtgctaagagttttgaggatatagggtcatacagggaacaaatt aaacgagtgaaggacgcagaagaagtgccgatggtgttagttggaaataagtgcgatttg caagcctgggctgtagatatgacgcaggcgagagaggttgcccgtagttatggagtgcct tttgttgagacctcagctaagacccgtatgggtgttgatgatgcattctacaccctagta agagagattcgcaaagataaagaaagccggggtaagaaatttaggcgtggaaataagtta ggttccaggcgttccttcaaatgtacactactttaa

DBGET integrated database retrieval system