Pseudomonas cannabina pv. alisalensis: JGS08_17150 Help Entry JGS08_17150       CDS       T07379                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pcab  Pseudomonas cannabina pv. alisalensis Pathway pcab00261   Monobactam biosynthesis pcab01100   Metabolic pathways pcab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcab00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     JGS08_17150  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pcab01008]     JGS08_17150 Polyketide biosynthesis proteins [BR:pcab01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     JGS08_17150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QQN20352 LinkDB All DBs Position complement(3851567..3851785) Genome browser AA seq 72 aa AA seqDB search MTSVFDREDIVFQVVVNHEEQYSIWPDYKAIPNGWRTVGKSGFKKECLAYIEEVWTDMRP LSLRQKMEAQTA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtattcgatcgggaagacatcgtctttcaagttgtggtcaaccacgaagaa cagtattcgatctggcccgactacaaagccatccccaacggctggcgcaccgtcggcaaa agcggcttcaagaaagagtgcctggcctacatcgaagaagtctggaccgacatgcgcccc ctgagcctgcgccagaagatggaagcgcagacggcctga

DBGET integrated database retrieval system