Pseudomonas chlororaphis subsp. piscium: C4K32_4349 Help Entry C4K32_4349        CDS       T09060                                  Name (GenBank) MbtH-like NRPS chaperone   KO K05375   MbtH protein Organism pchp  Pseudomonas chlororaphis subsp. piscium Pathway pchp00261   Monobactam biosynthesis pchp01100   Metabolic pathways pchp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pchp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     C4K32_4349  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pchp01008]     C4K32_4349 Polyketide biosynthesis proteins [BR:pchp01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     C4K32_4349 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AZC70997 LinkDB All DBs Position complement(4852539..4852763) Genome browser AA seq 74 aa AA seqDB search MTSVFDREDILFQVVVNHEEQYSIWPDYKAVPQGWRTVGKSGFKKECLAYIEEVWTDMRP LSLRQKMDAQAAAN NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtatttgaccgcgaggacatcctctttcaggtagtggtcaaccatgaggag cagtattcgatctggccggactacaaggctgtgccacaaggctggcgcaccgtgggcaag agcggcttcaagaaggagtgcctggcctacatcgaagaggtgtggaccgacatgcgcccg ctgagcctgcggcagaagatggacgcccaggcggccgccaactga

DBGET integrated database retrieval system