Pseudomonas cichorii: PCH70_31410 Help Entry PCH70_31410       CDS       T03002                                  Name (GenBank) mbtH-like protein   KO K05375   MbtH protein Organism pci  Pseudomonas cichorii Pathway pci00261   Monobactam biosynthesis pci01100   Metabolic pathways pci01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pci00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PCH70_31410  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pci01008]     PCH70_31410 Polyketide biosynthesis proteins [BR:pci01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PCH70_31410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AHF68294 LinkDB All DBs Position complement(3756951..3757178) Genome browser AA seq 75 aa AA seqDB search MTSVFDRDDIVFQVVVNHEEQYSIWPDYKAIPNGWRTVGKSGFKKECLAYIEEVWTDMRP LSLRQKMEAQAATAH NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacttcagttttcgaccgcgacgacatcgtctttcaggtcgtggtcaaccacgaagag caatattccatctggccggattacaaagcgatccccaacggctggcgcactgtgggcaag agcggcttcaagaaggaatgcctggcctacatcgaagaagtgtggaccgacatgcgccca ctgagcctgcgccagaagatggaagcacaggctgctactgcacactga

DBGET integrated database retrieval system