Paraprevotella clara: PC1C4_24000 Help Entry PC1C4_24000       CDS       T08732                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pclr  Paraprevotella clara Pathway pclr00020   Citrate cycle (TCA cycle) pclr01100   Metabolic pathways pclr01110   Biosynthesis of secondary metabolites pclr01120   Microbial metabolism in diverse environments pclr01200   Carbon metabolism pclr01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pclr00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     PC1C4_24000 Enzymes [BR:pclr01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      PC1C4_24000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_6 Fer4_7 Fer4_2 Fer4_10 Fer4_9 Fer4_16 Fer4_4 Fer4_15 Fer4_17 Fer4_8 Fer4_22 Fer4_13 Fer4_3 Tube Motif Other DBs NCBI-ProteinID:  BDI75678 LinkDB All DBs Position 3279857..3280087 Genome browser AA seq 76 aa AA seqDB search MGKFRGIIVVDRERCKGCNLCVVACPLHILALTEKQVNKKGYHYAEQVQKDLCNGCSSCG VVCPDGCITVYKKKEE NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggggaaattcagaggtataatcgtagtagaccgcgaacgctgcaaaggctgcaacctg tgtgtggtggcttgtccgctccatatattagcgctcacggaaaaacaagtaaacaaaaaa gggtatcattatgccgaacaagtccaaaaggatttgtgcaacggatgttcatcctgtggc gtggtgtgcccggacggatgcattaccgtatataaaaagaaagaagaataa

DBGET integrated database retrieval system