Segatella copri: LK433_05215 Help Entry LK433_05215       CDS       T07933                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pcoi  Segatella copri Pathway pcoi00020   Citrate cycle (TCA cycle) pcoi01100   Metabolic pathways pcoi01110   Biosynthesis of secondary metabolites pcoi01120   Microbial metabolism in diverse environments pcoi01200   Carbon metabolism pcoi01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pcoi00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     LK433_05215 Enzymes [BR:pcoi01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      LK433_05215 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_7 Fer4_21 Fer4_6 Fer4_9 Fer4_10 Fer4_16 Fer4_4 Fer4_17 Fer4_13 Fer4_8 Fer4_22 Fer4_15 Fer4_3 Chordopox_G2 Fer4_18 Motif Other DBs NCBI-ProteinID:  UEA43961 LinkDB All DBs Position 1275077..1275307 Genome browser AA seq 76 aa AA seqDB search MSKIKGAIVVDTGRCKGCSLCVEACPQHVIALAEKKVNVHGYRYVEAAVPDACVGCTSCA IVCPDGCITVYRKKED NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagtaagattaaaggggctattgtagtcgacaccgggcgttgcaagggatgctcgctc tgtgtggaggcttgtcctcagcatgtcatcgcattggcagagaaaaaagtcaatgtgcat ggttaccgttatgtagaggcagctgtacctgatgcgtgtgttggttgcacttcgtgcgcc atcgtgtgtccggacggctgtatcactgtttatcgtaagaaggaggactaa

DBGET integrated database retrieval system