Phocaeicola coprophilus: I6J50_03200 Help Entry I6J50_03200       CDS       T07209                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pcop  Phocaeicola coprophilus Pathway pcop00020   Citrate cycle (TCA cycle) pcop01100   Metabolic pathways pcop01110   Biosynthesis of secondary metabolites pcop01120   Microbial metabolism in diverse environments pcop01200   Carbon metabolism pcop01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pcop00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     I6J50_03200 Enzymes [BR:pcop01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      I6J50_03200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_6 Fer4_7 Fer4_21 Fer4_4 Fer4_9 Fer4_10 Fer4_16 Fer4_8 Fer4_22 Fer4_17 Fer4_3 Fer4_13 Fer4_15 Motif Other DBs NCBI-ProteinID:  QRO25295 LinkDB All DBs Position complement(738567..738797) Genome browser AA seq 76 aa AA seqDB search MAKIKGVVVVNTERCKGCNLCVVACPLHVLALTPKVNQKGYNYVQQAVEDVCNGCSSCAI VCPDGCLTVYRAKCEE NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctaagataaaaggtgtagttgttgtaaacacagagcgctgcaaaggatgcaaccta tgtgtagtagcatgcccattacatgtactcgctttaactccaaaggtaaaccagaaggga tataattatgtacaacaggcagtggaagatgtctgcaacggatgctcttcgtgtgccatt gtgtgcccggatggctgcctgaccgtatacagagcaaaatgtgaagaataa

DBGET integrated database retrieval system