Prevotella communis: L6468_10325 Help Entry L6468_10325       CDS       T09070                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pcou  Prevotella communis Pathway pcou00020   Citrate cycle (TCA cycle) pcou01100   Metabolic pathways pcou01110   Biosynthesis of secondary metabolites pcou01120   Microbial metabolism in diverse environments pcou01200   Carbon metabolism pcou01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pcou00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     L6468_10325 Enzymes [BR:pcou01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      L6468_10325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_2 Fer4_7 Fer4_6 Fer4_9 Fer4_10 Fer4_4 Fer4_16 Fer4_17 Fer4_22 Fer4_15 Fer4_8 Fer4_13 Fer4_3 Motif Other DBs NCBI-ProteinID:  UKK61383 LinkDB All DBs Position complement(2468505..2468735) Genome browser AA seq 76 aa AA seqDB search MAKMKGAIEVNTERCKGCSLCVIACPQKVIALANKVNLHGYPYVEAVNEEACVGCASCGI VCPDGCITVYRKKVEE NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaatgaaaggcgctattgaggtgaataccgagaggtgtaagggatgcagtctc tgcgtcatcgcctgccctcagaaggttatcgccctggccaacaaagttaatctgcacggt tatccctatgtggaggctgtcaacgaggaagcctgtgtgggctgtgcttcgtgtggcatt gtctgcccagatggctgtatcaccgtgtatcgtaaaaaagtggaggaataa

DBGET integrated database retrieval system