Prescottella defluvii: P9209_28675 Help Entry P9209_28675       CDS       T09037                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pdef  Prescottella defluvii Pathway pdef00261   Monobactam biosynthesis pdef01100   Metabolic pathways pdef01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pdef00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     P9209_28675  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pdef01008]     P9209_28675 Polyketide biosynthesis proteins [BR:pdef01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     P9209_28675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WFR72308 LinkDB All DBs Position complement(5508122..5508355) Genome browser AA seq 77 aa AA seqDB search MSTNPFDDEDGRFYVLVNDEDQHSLWPTFSEVPQGWRIVFGEDSRQACVEYVEKNWTDMR PKSLREAMEQDQKNAEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatccgttcgacgacgaagacggccgcttctacgtgctggtcaacgacgaa gaccagcattccctgtggcccacgttctccgaggtcccccagggctggaggatcgtcttc ggcgaggattcgcgtcaggcgtgcgtcgaatacgtcgagaagaactggaccgacatgcgg ccgaagagcttgcgtgaggccatggagcaggaccagaagaacgccgagaagtaa

DBGET integrated database retrieval system