Paraburkholderia dioscoreae: PDMSB3_2889.1 Help Entry PDMSB3_2889.1     CDS       T08115                                  Symbol mbtH Name (GenBank) Protein MbtH   KO K05375   MbtH protein Organism pdio  Paraburkholderia dioscoreae Pathway pdio00261   Monobactam biosynthesis pdio01100   Metabolic pathways pdio01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pdio00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PDMSB3_2889.1 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pdio01008]     PDMSB3_2889.1 (mbtH) Polyketide biosynthesis proteins [BR:pdio01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PDMSB3_2889.1 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  VVD34173 UniProt:  A0A5Q4ZN88 LinkDB All DBs Position II:complement(3014411..3014650) Genome browser AA seq 79 aa AA seqDB search MTQAQQSSSTAAGEADDLAYTVVINDEEQYSIWPSFRDVPAGWREVGVRGPKAECLAHIE TVWTDMRPASLRRHMDGTA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagcacagcagagttccagcacggcagccggcgaggcggacgatctcgcctac acggtcgtcatcaacgacgaagaacagtattcgatctggccgtccttccgcgacgtgccg gccggctggcgcgaagtgggcgtgcgcggcccgaaggccgaatgcctcgcgcacatcgag acggtctggaccgatatgcgcccggccagcttgcgccggcatatggacgggacggcctga

DBGET integrated database retrieval system