Pseudomonas aeruginosa DK2: PADK2_13210 Help Entry PADK2_13210       CDS       T02161                                  Name (GenBank) putative MbtH-like protein   KO K05375   MbtH protein Organism pdk  Pseudomonas aeruginosa DK2 Pathway pdk00261   Monobactam biosynthesis pdk01100   Metabolic pathways pdk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pdk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PADK2_13210  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pdk01008]     PADK2_13210 Polyketide biosynthesis proteins [BR:pdk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PADK2_13210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AFM64923 LinkDB All DBs Position 2817423..2817641 Genome browser AA seq 72 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPEYKEIPQGWRAAGKSGLKKDCLAYIEEVWTDMRP LSLRQHMDKAAG NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtgttcgaccgtgacgacatccagttccaggtagtggtcaaccatgaggag cagtattccatctggccggaatacaaggagattccccagggctggcgggcggccggcaag agcggcctgaagaaggactgcctggcctacatcgaggaagtctggaccgacatgcgcccg ctgagcctgcgccagcacatggacaaggcggccggctga

DBGET integrated database retrieval system