Penicillium digitatum: PDIP_86130 Help Entry PDIP_86130        CDS       T04849                                  Name (RefSeq) Hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism pdp  Penicillium digitatum Pathway pdp03020   RNA polymerase pdp03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pdp00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     PDIP_86130   09124 Replication and repair    03420 Nucleotide excision repair     PDIP_86130  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pdp03021]     PDIP_86130    03400 DNA repair and recombination proteins [BR:pdp03400]     PDIP_86130 Transcription machinery [BR:pdp03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      PDIP_86130   RNA polymerase III system    RNA polymerase III      PDIP_86130   RNA polymerase I system    RNA polymerase I      PDIP_86130 DNA repair and recombination proteins [BR:pdp03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       PDIP_86130 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_RNApol_7kD zf_UBZ DUF2197 HypA DZR DUF5816 YjdM_Zn_Ribbon DUF6510 LysW-like_globular Motif Other DBs NCBI-GeneID:  26236927 NCBI-ProteinID:  XP_014530662 UniProt:  K9F9P1 LinkDB All DBs Position Unknown AA seq 71 aa AA seqDB search MSRETYQVPSMGTQNNFDTQAGGFGNGMAIDSPSVTYLCGECSARVPLKRGDQIRCKDCG HRVLYKERTKR NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgtctcgcgaaacctaccaggtcccctcgatgggcacccagaacaacttcgatacccag gccggaggtttcggcaacggcatggccatcgacagcccctcggtcacctacctgtgcggc gaatgctctgcccgtgttcctctgaagcgcggcgaccagattcgttgcaaggattgcggt caccgtgtgctgtacaaggagcggaccaagcggtaa

DBGET integrated database retrieval system