Pseudomonas sp. ATCC 13867: H681_02440 Help Entry H681_02440        CDS       T02524                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism pdr  Pseudomonas sp. ATCC 13867 Pathway pdr00790   Folate biosynthesis pdr01100   Metabolic pathways pdr01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:pdr00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     H681_02440 Enzymes [BR:pdr01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      H681_02440  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      H681_02440  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      H681_02440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AGI22370 UniProt:  M4XAM2 LinkDB All DBs Position 539134..539487 Genome browser AA seq 117 aa AA seqDB search MDRVFIEGLEVDTVIGVYDWERGIRQCLRLDLTLGWDNRPAAADDDIAKALDYAVLSERV MAFARDAHFQLVETFAERLAELLMAEFGIQWLRLKVTKPGAVAAAIGVGVEIERGCR NT seq 354 nt NT seq  +upstreamnt  +downstreamnt gtggacagagttttcatcgaggggctggaagtggacaccgtgatcggcgtctacgactgg gagcggggtatccggcagtgcctgcgcctggacctgacgctgggttgggacaaccgcccg gcggcggccgacgacgacatcgccaaggccctggactacgccgtgctctccgaacgggtc atggccttcgcccgtgacgcgcatttccagctggtggaaacctttgccgagcgcctggcc gagctgctgatggcggagttcggcatccagtggctgcgcctgaaagtcaccaagcccggc gccgttgcggccgccattggcgtgggtgtggagatcgaacgcggatgccgctga

DBGET integrated database retrieval system