Pseudonocardia dioxanivorans: Psed_6162 Help Entry Psed_6162         CDS       T01479                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism pdx  Pseudonocardia dioxanivorans Pathway pdx00261   Monobactam biosynthesis pdx01100   Metabolic pathways pdx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pdx00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Psed_6162  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pdx01008]     Psed_6162 Polyketide biosynthesis proteins [BR:pdx01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Psed_6162 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AEA28264 UniProt:  F4CNG6 LinkDB All DBs Position complement(6520938..6521162) Genome browser AA seq 74 aa AA seqDB search MSGNPFDDEGGVFYALINDEGQYSLWPTFAVVPDGWTVVFGEASRQECLDHIEANWTDMR PKSLIEQMEGAAGA NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgtccggtaatccgttcgacgacgagggcggcgtcttctacgccctgatcaacgacgag ggccagtactccctgtggcccacgttcgcggtcgtcccggacggctggacggtcgtcttc ggggaggcgtcgcgccaggagtgcctcgaccacatcgaggccaactggacggacatgcgg ccgaagagcctgatcgaacagatggaaggcgccgccggcgcctga

DBGET integrated database retrieval system