Pectobacterium parmentieri SCC3193: W5S_3875 Help Entry W5S_3875          CDS       T02514                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism pec  Pectobacterium parmentieri SCC3193 Pathway pec00261   Monobactam biosynthesis pec01100   Metabolic pathways pec01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pec00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     W5S_3875  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pec01008]     W5S_3875 Polyketide biosynthesis proteins [BR:pec01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     W5S_3875 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AFI91938 UniProt:  A0A0H3I8Y0 LinkDB All DBs Position complement(4177193..4177399) Genome browser AA seq 68 aa AA seqDB search MSQEQQNPFDNDSLTFYVLMNTQRQYSLWPAFADVPAGWHQVIGPDTRTACMTYIETHWV DMRPASLQ NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgagccaggaacagcaaaatccttttgataatgacagtctgacattttacgtactcatg aatacgcaacgtcaatacagcctctggcctgcgtttgccgacgttcctgcgggatggcat caggttattggcccagacacgcgaacggcctgcatgacttatatcgaaactcactgggtg gacatgcggcctgccagcctgcaatag

DBGET integrated database retrieval system