Pseudomonas entomophila: PSEEN3329 Help Entry PSEEN3329         CDS       T00362                                  Name (GenBank) conserved hypothetical protein   KO K05375   MbtH protein Organism pen  Pseudomonas entomophila Pathway pen00261   Monobactam biosynthesis pen01100   Metabolic pathways pen01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pen00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PSEEN3329  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pen01008]     PSEEN3329 Polyketide biosynthesis proteins [BR:pen01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PSEEN3329 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CAK16083 UniProt:  Q1I8E5 LinkDB All DBs Position complement(3587568..3587789) Genome browser AA seq 73 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPDYKAIPNGWRAVGKSGLKKDCLAYIDEVWTDMRP LSLRQQMAEAAAQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacttccgttttcgaccgcgacgacatccagttccaggtagtggtcaaccacgaagag cagtattccatctggcctgattacaaggcgatccccaatggctggcgcgcggtcggcaag agcggcctgaagaaggactgcctggcctacatcgacgaggtgtggaccgacatgcgcccg ttgagcctgcgccagcagatggccgaagccgcggcgcagtga

DBGET integrated database retrieval system