Porphyromonas endodontalis: LA319_00215 Help Entry LA319_00215       CDS       T08002                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pend  Porphyromonas endodontalis Pathway pend00020   Citrate cycle (TCA cycle) pend01100   Metabolic pathways pend01110   Biosynthesis of secondary metabolites pend01120   Microbial metabolism in diverse environments pend01200   Carbon metabolism pend01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pend00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     LA319_00215 Enzymes [BR:pend01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      LA319_00215 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_7 Fer4_6 Fer4_21 Fer4_9 Fer4_16 Fer4_10 Fer4_4 Fer4_15 Fer4_13 Fer4_17 Fer4_3 Fer4_8 Motif Other DBs NCBI-ProteinID:  UBH64655 LinkDB All DBs Position complement(54001..54231) Genome browser AA seq 76 aa AA seqDB search MAKVRGAVVVNQQRCKGCNLCVVACPTQAISLHPDHMNDKGYHYCYMSNPEACIGCTSCG MVCPDGCISVYKVTQK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcgaaagttagaggagctgttgtagtcaatcaacagcgttgtaaaggttgcaatctc tgcgttgtggcttgccctacgcaggcgattagcttgcatcccgatcacatgaatgacaag ggatatcactattgttacatgagcaatcctgaggcttgcattggctgcactagttgcggt atggtatgccccgatggttgcatctcagtgtataaagtaactcagaaataa

DBGET integrated database retrieval system