Pseudomonas eucalypticola: HWQ56_11565 Help Entry HWQ56_11565       CDS       T07251                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pez  Pseudomonas eucalypticola Pathway pez00261   Monobactam biosynthesis pez01100   Metabolic pathways pez01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pez00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HWQ56_11565  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pez01008]     HWQ56_11565 Polyketide biosynthesis proteins [BR:pez01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HWQ56_11565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QKZ04391 UniProt:  A0A7D5HWM5 LinkDB All DBs Position 2527343..2527573 Genome browser AA seq 76 aa AA seqDB search MTSVFDREDILFQVVVNHEEQYSIWPDYKAVPNGWRTVGKSGFKKECLAYIEEVWTDMRP LSLRKHMEEQAAQATH NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgacctccgtattcgatcgcgaagacatcctgttccaggtagtggtcaaccacgaagag caatactccatctggcctgactacaaggccgtgcccaacggctggcgcaccgttggcaag agcggtttcaagaaagagtgcctggcctacatcgaagaagtgtggaccgacatgcgcccc ctgagcctgcgcaagcacatggaagagcaagccgcccaagccactcattga

DBGET integrated database retrieval system