Pseudomonas eucalypticola: HWQ56_12505 Help Entry HWQ56_12505       CDS       T07251                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pez  Pseudomonas eucalypticola Pathway pez00261   Monobactam biosynthesis pez01100   Metabolic pathways pez01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pez00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HWQ56_12505  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pez01008]     HWQ56_12505 Polyketide biosynthesis proteins [BR:pez01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HWQ56_12505 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QKZ04558 UniProt:  A0A7D5D772 LinkDB All DBs Position 2775901..2776125 Genome browser AA seq 74 aa AA seqDB search MEHLNPFDDPQQVCHVLINAQGQHSLWPDFCDVPPGWSIVYGPASREACGQWLEAHWRDL RPASLRRLLAADAT NT seq 225 nt NT seq  +upstreamnt  +downstreamnt gtggagcacctcaaccccttcgacgacccgcagcaggtttgccatgtgctgatcaatgcc cagggccagcacagcctgtggccggacttctgcgacgtgccgcccggttggagcatcgtc tatggccccgccagccgcgaagcgtgcggccagtggctggaagcccactggcgcgacctg cgtcccgcctcgctgcgccgcctgctggcggccgacgccacttga

DBGET integrated database retrieval system