Phascolarctobacterium faecium: PFJ30894_02300 Help Entry PFJ30894_02300    CDS       T05784                                  Name (GenBank) Ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pfac  Phascolarctobacterium faecium Pathway pfac00020   Citrate cycle (TCA cycle) pfac01100   Metabolic pathways pfac01110   Biosynthesis of secondary metabolites pfac01120   Microbial metabolism in diverse environments pfac01200   Carbon metabolism pfac01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pfac00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     PFJ30894_02300 Enzymes [BR:pfac01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      PFJ30894_02300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_7 Fer4_2 Fer4_9 Fer4_10 Fer4_21 Fer4_4 Fer4_16 Fer4_8 Fer4_17 Fer4_3 Fer4_22 Fer4_13 Fer4_15 Motif Other DBs NCBI-ProteinID:  BBG64627 LinkDB All DBs Position complement(2360260..2360442) Genome browser AA seq 60 aa AA seqDB search MSLKVHTNRCKGCGICVAFCPKQVLAISEIEKVEVVAEDKCIQCGQCETRCPDFAIFVEK NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgagtctgaaggtccatacaaatcgctgcaaaggctgcgggatctgcgtagcattttgc cccaaacaggttttggcaatcagcgagatcgaaaaagtagaggtggtcgccgaggataaa tgtatccaatgcggccagtgcgaaacacgctgccctgactttgcgatttttgtagaaaag taa

DBGET integrated database retrieval system