Pseudomonas fakonensis: KSS94_16545 Help Entry KSS94_16545       CDS       T07698                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pfak  Pseudomonas fakonensis Pathway pfak00261   Monobactam biosynthesis pfak01100   Metabolic pathways pfak01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfak00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KSS94_16545  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pfak01008]     KSS94_16545 Polyketide biosynthesis proteins [BR:pfak01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KSS94_16545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QXH49557 LinkDB All DBs Position complement(3779408..3779626) Genome browser AA seq 72 aa AA seqDB search MTSVFDRDDIVFQVVVNHEEQYSIWPDYKAIPNGWRAVGKSGLKKDCLAYIDEVWTDMRP LSLRQQMAAAAQ NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacttccgtattcgaccgcgacgacatcgtgttccaggtagtggtcaaccacgaagag caatattccatctggcccgactacaaggccatccccaacggctggcgcgcggtgggcaag agcggcctgaaaaaagactgcctggcctacatcgacgaagtctggaccgacatgcgcccg ctgagcctgcgccagcagatggcagccgcggcgcagtga

DBGET integrated database retrieval system