Pseudomonas fluorescens A506: PflA506_3682 Help Entry PflA506_3682      CDS       T02114                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism pfc  Pseudomonas fluorescens A506 Pathway pfc00261   Monobactam biosynthesis pfc01100   Metabolic pathways pfc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfc00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PflA506_3682  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pfc01008]     PflA506_3682 Polyketide biosynthesis proteins [BR:pfc01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PflA506_3682 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AFJ56268 LinkDB All DBs Position complement(4079221..4079445) Genome browser AA seq 74 aa AA seqDB search MTSVFDRDDILFQVVVNHEEQYSIWPDYKAVPEGWRTVGKSGMKKECLAYIEEVWTDMRP LSLRQKMDGAALAN NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacctcagtatttgaccgcgacgacatcctctttcaggtagtggtcaaccatgaagaa cagtattcgatctggcccgactacaaggccgtgccggaaggctggcgcaccgtgggcaag agcggcatgaagaaagaatgcctggcctacatcgaggaagtgtggaccgatatgcgcccg ctgagcctgcgccagaaaatggacggcgcggccctcgccaactga

DBGET integrated database retrieval system