Pseudomonas ogarae: PSF113_1758 Help Entry PSF113_1758       CDS       T01734                                  Name (GenBank) Hypothetical protein   KO K05375   MbtH protein Organism pfe  Pseudomonas ogarae Pathway pfe00261   Monobactam biosynthesis pfe01100   Metabolic pathways pfe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfe00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PSF113_1758  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pfe01008]     PSF113_1758 Polyketide biosynthesis proteins [BR:pfe01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PSF113_1758 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AEV61782 LinkDB All DBs Position 2049494..2049721 Genome browser AA seq 75 aa AA seqDB search MTSVFDREDIVFQVVVNHEEQYSIWPDYKAVPEGWRTVGKSGFKKECLAYIEEVWTDMRP LSLRKKMEEQAAAVH NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtattcgaccgcgaggacatcgtctttcaggtcgtggtcaaccacgaagaa cagtattcgatctggccagactacaaggctgttcccgaaggctggcgtaccgtcggcaaa agcgggttcaagaaggaatgcctggcctacatcgaagaagtctggaccgacatgcgcccg ctgagcctgcgcaagaagatggaagagcaggcggctgcggttcactaa

DBGET integrated database retrieval system