Pseudomonas fitomaticsae: KJY40_20310 Help Entry KJY40_20310       CDS       T08740                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pfit  Pseudomonas fitomaticsae Pathway pfit00261   Monobactam biosynthesis pfit01100   Metabolic pathways pfit01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pfit00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KJY40_20310  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pfit01008]     KJY40_20310 Polyketide biosynthesis proteins [BR:pfit01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KJY40_20310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UFP98381 LinkDB All DBs Position complement(4541126..4541350) Genome browser AA seq 74 aa AA seqDB search MTSVFDREDILFQVVVNHEEQYSIWPDYKAVPEGWRTVGKSGLKKECLAYIEEVWTDMRP LSLRQKMEAQAAAQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgtcagtattcgaccgcgaggacatcctctttcaagtcgtggttaaccacgaagag cagtactcgatctggccggactacaaggccgtgccggaaggctggcgcaccgtcggcaag agtggtctgaaaaaggaatgcctggcctacatcgaagaagtctggaccgacatgcgtccg ctgagcctgcgccagaagatggaagcgcaagcggctgcccagtaa

DBGET integrated database retrieval system